PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do027670.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family Dof
Protein Properties Length: 230aa    MW: 23529 Da    PI: 9.8828
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do027670.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.65e-372985359
      zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59
                 + l+cprC+s ntkfCyynny+lsqPr+fC+aCrryWt+GGalrnvPvGg +rk  
  Do027670.1 29 PEGLPCPRCESVNTKFCYYNNYNLSQPRHFCRACRRYWTRGGALRNVPVGGNTRKAT 85
                57899*************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-223182IPR003851Zinc finger, Dof-type
PfamPF027011.2E-323284IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.6583286IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103470IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MEAGQVAEGG ALAVVATATG LRAGGGREPE GLPCPRCESV NTKFCYYNNY NLSQPRHFCR  60
ACRRYWTRGG ALRNVPVGGN TRKATPVARR KRTGGAPPAP ASPTAAPAPA LPPLTMLGTH  120
GALLRQYGLA FPAPALASPL AAVDPDRRLL DLGGSFSSLI AAAAPAPDVG VHFSAGFLVG  180
GLAPGLAHAP ASAAATLPPP PPPPPQQQQV SSQALPEGLI WSMGWPDLSI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457194.16e-80hypothetical protein SORBIDRAFT_03g003050
TrEMBLC5XLX96e-80C5XLX9_SORBI; Dof-type zinc finger protein 27
STRINGSb03g003050.12e-79(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50410.18e-31OBF binding protein 1